Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IARS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human IARS (NP_002152.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IARS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human IARS (NP_002152.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09002A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IARS |
| Target Synonyms | IRS; IARS; ILRS; ILERS; GRIDHH; PRO0785 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, HL-60, HT-29, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human IARS (NP_002152.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF | Uniprot ID | P41252 |
Uniprot Id
P41252
Target Species
Human
Target Name
IARS1
Target Full Name
Isoleucine--tRNA ligase, cytoplasmic
Target Function
Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.
Target Involvement
Growth retardation, intellectual developmental disorder, hypotonia, and hepatopathy (GRIDHH)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytosol.
Target Protein Families
Class-I aminoacyl-tRNA synthetase family
Target Tissue Specificity
Expressed in liver and muscle (at protein level).
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
IARS1; IARS; Isoleucine--tRNA ligase; cytoplasmic; EC 6.1.1.5; Isoleucyl-tRNA synthetase; IRS; IleRS
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
