Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICAM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-180 of human ICAM5 (NP_003250.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ICAM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-180 of human ICAM5 (NP_003250.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09764A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICAM5 |
| Target Synonyms | TLN; TLCN; ICAM5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 32-180 of human ICAM5 (NP_003250.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAV | Uniprot ID | Q9UMF0 |
Uniprot Id
Q9UMF0
Target Species
Human
Target Name
ICAM5
Target Full Name
Intercellular adhesion molecule 5
Target Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2).
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, ICAM family
Target Tissue Specificity
Expressed on neurons in the most rostral segment of the mammalian brain, the telencephalon.
Target Synonyms
ICAM5; TLCN; TLNIntercellular adhesion molecule 5; ICAM-5; Telencephalin
Target Background
The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes. It may be a critical component in neuron-microglial cell interactions in the course of normal development or as part of neurodegenerative diseases.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
