-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IDH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human IDH1 (NP_005887.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IDH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human IDH1 (NP_005887.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12343A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IDH1 |
| Target Synonyms | IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26; IDH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, Monkey | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, C2C12, Mouse liver, Rat kidney, Rat liver, Rat ovary | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human IDH1 (NP_005887.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA | Uniprot ID | O75874 |
Uniprot Id
O75874
Target Species
Human
Target Name
IDH1
Target Full Name
Isocitrate dehydrogenase [NADP] cytoplasmic
Target Involvement
Glioma (GLM)
Target Subcellular Location
Cytoplasm, cytosol. Peroxisome.
Target Protein Families
Isocitrate and isopropylmalate dehydrogenases family
Target Research Area
Cancer
Target Synonyms
Cytosolic NADP isocitrate dehydrogenase; Cytosolic NADP-isocitrate dehydrogenase; Epididymis luminal protein 216; Epididymis secretory protein Li 26; HEL-216; HEL-S-26; ICDH; IDCD; IDH; IDH1; IDHC_HUMAN; IDP; IDPC; Isocitrate dehydrogenase (NADP(+)) 1 cytosolic; Isocitrate dehydrogenase [NADP] cytoplasmic; Isocitrate dehydrogenase 1 (NADP+) soluble; NADP dependent isocitrate dehydrogenase cytosolic; NADP dependent isocitrate dehydrogenase peroxisomal; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; PICD
Target Background
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Notification