Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IDI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human IDI2 (NP_150286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IDI2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human IDI2 (NP_150286.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05642A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IDI2 |
| Target Synonyms | IPPI2; IDI2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human IDI2 (NP_150286.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELW | Uniprot ID | Q9BXS1 |
Uniprot Id
Q9BXS1
Target Species
Human
Target Name
IDI2
Target Full Name
Isopentenyl-diphosphate delta-isomerase 2
Target Function
Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
Target Subcellular Location
Peroxisome.
Target Protein Families
IPP isomerase type 1 family
Target Tissue Specificity
Muscle-specific expression.
Target Synonyms
IDI2; Isopentenyl-diphosphate delta-isomerase 2; EC 5.3.3.2; Isopentenyl pyrophosphate isomerase 2; IPP isomerase 2; IPPI2
Target Background
The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication event, encodes a protein that may be involved in the aggregation of alpha-synuclein in the cerebral cortex of patients with Lewy body disease. In addition, segmental copy number gains in this locus have been associated with sporadic amyotrophic lateral sclerosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
