-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFNAR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 458-557 of human IFNAR1 (P17181) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IFNAR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 458-557 of human IFNAR1 (P17181) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13742A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFNAR1 |
| Target Synonyms | AVP; IFRC; IFNAR; IFNBR; IMD106; IFN-alpha-REC; IFNAR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, A-549, Hep G2, Mouse brain, Rat liver, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 458-557 of human IFNAR1 (P17181). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV | Uniprot ID | P17181 |
Uniprot Id
P17181
Target Species
Human
Target Name
IFNAR1
Target Full Name
Interferon alpha/beta receptor 1
Target Function
Component of the receptor for type I interferons, including interferons alpha, IFNB1 and IFNW1. Functions in general as heterodimer with IFNAR2. Type I interferon binding activates the JAK-STAT signaling cascade, and triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and the IFNR alpha- and beta-subunits themselves. Can form an active IFNB1 receptor by itself and activate a signaling cascade that does not involve activation of the JAK-STAT pathway.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Late endosome. Lysosome.
Target Protein Families
Type II cytokine receptor family
Target Tissue Specificity
IFN receptors are present in all tissues and even on the surface of most IFN-resistant cells. Isoform 1, isoform 2 and isoform 3 are expressed in the IFN-alpha sensitive myeloma cell line U266B1. Isoform 2 and isoform 3 are expressed in the IFN-alpha resi
Target Synonyms
Alpha type antiviral protein; Antiviral protein, alpha-type; Antiviral protein, beta-type; AVP; Beta type antiviral protein; CRF2-1; Cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; IFN alpha REC; IFN alpha receptor; IFN alpha/beta Receptor alpha; IFN beta receptor; IFN Interferon-beta receptor; IFN-alpha/beta receptor 1; IFN-R-1; IFNAR; Ifnar1; IFNBR; IFRC; INAR1_HUMAN; Interferon (alpha beta and omega) receptor 1; interferon alpha and beta receptor subunit 1; Interferon alpha/beta receptor 1; Interferon alpha/beta receptor alpha chain; Interferon beta receptor 1; interferon receptor 1; Interferon-alpha receptor; Type I interferon receptor 1
Target Background
The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The protein belongs to the type II cytokine receptor family and functions as an antiviral factor.
Notification