-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFNGR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 390-489 of human IFNGR1 (P15260) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IFNGR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 390-489 of human IFNGR1 (P15260) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14671A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFNGR1 |
| Target Synonyms | CD119; IFNGR; IMD27A; IMD27B; IFNGR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, BxPC-3, Mouse liver, Mouse spleen, Mouse thymus, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 390-489 of human IFNGR1 (P15260). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSIALNSYHSRNCSESDHSRNGFDTDSSCLESHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTEDSKEFS | Uniprot ID | P15260 |
Uniprot Id
P15260
Target Species
Human
Target Name
IFNGR1
Target Full Name
Interferon gamma receptor 1
Target Function
Receptor subunit for interferon gamma/INFG that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Associates with transmembrane accessory factor IFNGR2 to form a functional receptor. Upon ligand binding, the intracellular domain of IFNGR1 opens out to allow association of downstream signaling components JAK1 and JAK2. In turn, activated JAK1 phosphorylates IFNGR1 to form a docking site for STAT1. Subsequent phosphorylation of STAT1 leads to dimerization, translocation to the nucleus, and stimulation of target gene transcription. STAT3 can also be activated in a similar manner although activation seems weaker. IFNGR1 intracellular domain phosphorylation also provides a docking site for SOCS1 that regulates the JAK-STAT pathway by competing with STAT1 binding to IFNGR1.
Target Involvement
Immunodeficiency 27A (IMD27A); Immunodeficiency 27B (IMD27B)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Type II cytokine receptor family
Target Research Area
Immunology
Target Synonyms
IFNGR1; Interferon gamma receptor 1; IFN-gamma receptor 1; IFN-gamma-R1; CDw119; Interferon gamma receptor alpha-chain; IFN-gamma-R-alpha; CD antigen CD119
Target Background
This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
Notification