Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IGFBP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-167 of human IGFBP5 (NP_000590.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IGFBP5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 68-167 of human IGFBP5 (NP_000590.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10729A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IGFBP5 |
| Target Synonyms | IBP5; IGFBP5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, BT-474, Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 68-167 of human IGFBP5 (NP_000590.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVG | Uniprot ID | P24593 |
Uniprot Id
P24593
Target Species
Human
Target Name
IGFBP5
Target Full Name
Insulin-like growth factor-binding protein 5
Target Function
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Osteosarcoma, and at lower levels in liver, kidney and brain.
Target Research Area
Signal Transduction
Target Synonyms
IBP 5; IBP-5; IBP5; IBP5_HUMAN; IGF binding protein 5; IGF BP5; IGF-binding protein 5; IGFBP 5; IGFBP-5; IGFBP5; Insulin like growth factor binding protein 5; Insulin-like growth factor-binding protein 5
Target Background
Enables insulin-like growth factor I binding activity. Involved in several processes, including cellular response to cAMP; regulation of smooth muscle cell migration; and regulation of smooth muscle cell proliferation. Part of insulin-like growth factor ternary complex. Biomarker of pulmonary fibrosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
