Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IGFBP7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGFBP7 (Q16270) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IGFBP7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGFBP7 (Q16270) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16069A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IGFBP7 |
| Target Synonyms | AGM; PSF; TAF; FSTL2; IBP-7; MAC25; IGFBP-7; RAMSVPS; IGFBP-7v; IGFBPRP1; IGFBP7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, SK-OV-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGFBP7 (Q16270). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQ | Uniprot ID | Q16270 |
Uniprot Id
Q16270
Target Species
Human
Target Name
IGFBP7
Target Full Name
Insulin-like growth factor-binding protein 7
Target Function
Binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
Target Involvement
Retinal arterial macroaneurysm with supravalvular pulmonic stenosis (RAMSVPS)
Target Subcellular Location
Secreted.
Target Research Area
Cancer
Target Synonyms
AGM; Angiomodulin; FSTL2; IBP-7; IBP7; IBP7_HUMAN; IGF binding protein 7; IGF-binding protein 7; IGFBP rP1; IGFBP-7; IGFBP-rP1; IGFBP7; IGFBPRP1; Insulin like growth factor binding protein 7; Insulin-like growth factor-binding protein 7; MAC25; MAC25 protein; PGI2 stimulating factor; PGI2-stimulating factor; Prostacyclin stimulating factor; Prostacyclin-stimulating factor; PSF; RAMSVPS; TAF; Tumor-derived adhesion factor
Target Background
This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm (PMID:21835307).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
