-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IKZF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human IKZF3 (Q9UKT9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against IKZF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human IKZF3 (Q9UKT9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-14402A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IKZF3 |
| Target Synonyms | AIO; IMD84; AIOLOS; ZNFN1A3; IKZF3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse thymus, Raji, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human IKZF3 (Q9UKT9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK | Uniprot ID | Q9UKT9 |
Uniprot Id
Q9UKT9
Target Species
Human
Target Name
IKZF3
Target Full Name
Zinc finger protein Aiolos
Target Function
Transcription factor that plays an important role in the regulation of lymphocyte differentiation. Plays an essential role in regulation of B-cell differentiation, proliferation and maturation to an effector state. Involved in regulating BCL2 expression and controlling apoptosis in T-cells in an IL2-dependent manner.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Ikaros C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed most strongly in peripheral blood leukocytes, the spleen, and the thymus.
Target Synonyms
AIO; Aiolos; IKAROS family zinc finger 3 (Aiolos); IKAROS family zinc finger 3; Ikaros family zinc finger protein 3; IKZF 3; IKZF3; IKZF3_HUMAN; zinc finger DNA binding protein Aiolos; Zinc finger protein Aiolos; Zinc finger protein subfamily 1A 3 (Aiolos); Zinc finger protein subfamily 1A 3; Zinc finger protein subfamily 1A; member 3; ZNFN1A3
Target Background
This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. Several alternative transcripts encoding different isoforms have been described, as well as some non-protein coding variants.
Notification