-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ILF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ILF2 (Q12905) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ILF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human ILF2 (Q12905) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13224A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ILF2 |
| Target Synonyms | NF45; PRO3063; ILF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse thymus, Raji, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ILF2 (Q12905). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT | Uniprot ID | Q12905 |
Uniprot Id
Q12905
Target Species
Human
Target Name
ILF2
Target Full Name
Interleukin enhancer-binding factor 2
Target Function
Appears to function predominantly as a heterodimeric complex with ILF3. This complex may regulate transcription of the IL2 gene during T-cell activation. It can also promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA. Essential for the efficient reshuttling of ILF3 (isoform 1 and isoform 2) into the nucleus.
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm. Nucleus. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Target Research Area
Transcription
Target Synonyms
HGNC:6037; ILF 2; ilf2; ILF2_HUMAN; Interleukin enhancer binding factor 2; Interleukin enhancer binding factor 2; 45kDa; Interleukin enhancer-binding factor 2; MGC8391; NF 45; NF45; Nuclear factor of activated T cells 45 kDa; Nuclear factor of activated T-cells 45 kDa; PRO3063
Target Background
The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14.
Notification