-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ILF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 597-706 of human ILF3 (NP_001131145.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ILF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 597-706 of human ILF3 (NP_001131145.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05892A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ILF3 |
| Target Synonyms | CBTF; DRBF; MMP4; MPP4; NF90; NFAR; NF110; NF90a; NF90b; NF90c; NFAR2; TCP80; DRBP76; NF110b; NFAR-1; NFAR-2; NFAR90; TCP110; MPP4110; NF90ctv; NFAR110; MPHOSPH4; NF-AT-90; ILF3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse thymus, Rat kidney, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 597-706 of human ILF3 (NP_001131145.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLALDANKKKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRGRGRGRGFGGANHGGYMNAGAGYGSYGYGGNSATAGYSDFFTDCYGYHDFGSS | Uniprot ID | Q12906 |
Uniprot Id
Q12906
Target Species
Human
Target Name
ILF3
Target Full Name
Interleukin enhancer-binding factor 3
Target Function
RNA-binding protein that plays an essential role in the biogenesis of circular RNAs (circRNAs) which are produced by back-splicing circularization of pre-mRNAs. Within the nucleus, promotes circRNAs processing by stabilizing the regulatory elements residing in the flanking introns of the circularized exons. Plays thereby a role in the back-splicing of a subset of circRNAs. As a consequence, participates in a wide range of transcriptional and post-transcriptional processes. Binds to poly-U elements and AU-rich elements (AREs) in the 3'-UTR of target mRNAs. Upon viral infection, ILF3 accumulates in the cytoplasm and participates in the innate antiviral response. Mechanistically, ILF3 becomes phosphorylated and activated by the double-stranded RNA-activated protein kinase/PKR which releases ILF3 from cellular mature circRNAs. In turn, unbound ILF3 molecules are able to interact with and thus inhibit viral mRNAs.
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm. Nucleus.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
CBTF; Double stranded RNA binding protein 76; Double-stranded RNA-binding protein 76; DRBF; DRBP76; ILF3; ILF3_HUMAN; Interleukin enhancer binding factor 3; Interleukin enhancer-binding factor 3; M phase phosphoprotein 4; M-phase phosphoprotein 4; MPHOSPH4; MPP4; NF AT 90; NF-AT-90; NF110; NF90; NFAR; Nuclear factor associated with dsRNA; Nuclear factor of activated T cells 90 kDa; Nuclear factor of activated T-cells 90 kDa; TCP80; Translational control protein 80
Target Background
This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein (NF90, ILF3) forms a heterodimer with a 45 kDa transcription factor (NF45, ILF2) required for T-cell expression of interleukin 2. This complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification