-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Integrin alpha 4 (ITGA4/CD49d) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4 (ITGA4/CD49d) (P13612) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Integrin alpha 4 (ITGA4/CD49d) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4 (ITGA4/CD49d) (P13612) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13836A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Integrin alpha 4 (ITGA4/CD49d) |
| Target Synonyms | IA4; CD49D; Integrin alpha 4 (ITGA4/CD49d) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse spleen, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4 (ITGA4/CD49d) (P13612). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD | Uniprot ID | P13612 |
Uniprot Id
P13612
Target Species
Human
Target Name
ITGA4
Target Full Name
Integrin alpha-4
Target Function
Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta-1 recognizes the sequence Q-I-D-S in VCAM1. Integrin alpha-4/beta-7 is also a receptor for MADCAM1. It recognizes the sequence L-D-T in MADCAM1. On activated endothelial cells integrin VLA-4 triggers homotypic aggregation for most VLA-4-positive leukocyte cell lines. It may also participate in cytolytic T-cell interactions with target cells. ITGA4:ITGB1 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1-dependent fractalkine signaling. ITGA4:ITGB1 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Integrin alpha chain family
Target Research Area
Immunology
Target Synonyms
269C wild type; Antigen CD49D, alpha 4 subunit of VLA 4 receptor; CD49 antigen like family member D; CD49 antigen-like family member D; CD49d; IA4; Integrin alpha 4; Integrin alpha 4 subunit; Integrin alpha IV; Integrin alpha-4; Integrin alpha-IV; Integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA 4 receptor); ITA4_HUMAN; ITGA4; MGC90518; OTTHUMP00000205320; Very late activation protein 4 receptor, alpha 4 subunit; VLA 4 subunit alpha; VLA-4 subunit alpha; VLA4
Target Background
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 4 subunit. This subunit associates with a beta 1 or beta 7 subunit to form an integrin that may play a role in cell motility and migration. This integrin is a therapeutic target for the treatment of multiple sclerosis, Crohn's disease and inflammatory bowel disease. Alternative splicing results in multiple transcript variants.
Notification