Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IP6K2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human IP6K2 (NP_057375.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against IP6K2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human IP6K2 (NP_057375.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of A549 cells using IP6K2 antibody. Blue: DAPI for nuclear staining.
| Cat.No | ADA-06251A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IP6K2 |
| Target Synonyms | PIUS; IHPK2; InsP6K2; IP6K2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human IP6K2 (NP_057375.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWS | Uniprot ID | Q9UHH9 |
Uniprot Id
Q9UHH9
Target Species
Human
Target Name
IP6K2
Target Full Name
Inositol hexakisphosphate kinase 2
Target Function
Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5).
Target Subcellular Location
Nucleus.
Target Protein Families
Inositol phosphokinase (IPK) family
Target Synonyms
ATP 1D myo inositol hexakisphosphate phosphotransferase ; IHPK 2; IHPK2; Inositol hexakisphosphate kinase 2; InsP6 kinase 2; Ip6k2; IP6K2_HUMAN; KIAA0263; OTTHUMP00000164824; P(i) uptake stimulator; P(i)-uptake stimulator; Pi uptake stimulator; PiUS
Target Background
This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1, 3, 4, 5, 6-pentakisphosphate (InsP5) to PP-InsP4 and affect the growth suppressive and apoptotic activities of interferon-beta in some ovarian cancers. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
