-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IPO11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 776-975 of human IPO11 (NP_057422.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IPO11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 776-975 of human IPO11 (NP_057422.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05509A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IPO11 |
| Target Synonyms | RanBP11; IPO11 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, 293T, A-549, Mouse lung, Mouse spleen, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 776-975 of human IPO11 (NP_057422.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGIIEGERYPVVMSTYLGVMGRVLLQNTSFFSSLLNEMAHKFNQEMDQLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQDKRKKMLALKDPVHTVSLQQFIYEKLKAQQEMLGEQGFQSLMETVDTEIVTQLQEFLQGF | Uniprot ID | Q9UI26 |
Uniprot Id
Q9UI26
Target Species
Human
Target Name
IPO11
Target Full Name
Importin-11
Target Function
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates the nuclear import of UBE2E3, and of RPL12.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Importin beta family
Target Synonyms
Imp11; Importin 11; Importin-11; IPO11; IPO11_HUMAN; Ran binding protein 11; Ran-binding protein 11; RanBP11; SLRN; Synleurin
Target Background
Importins, including IPO11, are a members of the karyopherin/importin-beta family of transport receptors (see KPNB1; 602738) that mediate nucleocytoplasmic transport of protein and RNA cargoes (Plafker and Macara, 2000 [PubMed 11032817]).
Notification