Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IRF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-300 of human IRF6 (NP_006138.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IRF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-300 of human IRF6 (NP_006138.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03125A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IRF6 |
| Target Synonyms | LPS; PIT; PPS; VWS; OFC6; PPS1; VWS1; IRF6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 22Rv1, 293T, BT-474, HT-29, MCF7, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 115-300 of human IRF6 (NP_006138.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIPQPQGSIINPGSTGSAPWDEKDNDVDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDR | Uniprot ID | O14896 |
Uniprot Id
O14896
Target Species
Human
Target Name
IRF6
Target Full Name
Interferon regulatory factor 6
Target Function
Probable DNA-binding transcriptional activator. Key determinant of the keratinocyte proliferation-differentiation switch involved in appropriate epidermal development. Plays a role in regulating mammary epithelial cell proliferation. May regulate WDR65 transcription.
Target Involvement
Van der Woude syndrome 1 (VWS1); Popliteal pterygium syndrome (PPS); Non-syndromic orofacial cleft 6 (OFC6)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
IRF family
Target Tissue Specificity
Expressed in normal mammary epithelial cells. Expression is reduced or absent in breast carcinomas.
Target Synonyms
Interferon regulatory factor 6; IRF 6; IRF-6; IRF6; IRF6_HUMAN; LPS; OFC 6; OFC6; OTTHUMP00000034677; OTTHUMP00000034678; PIT; PPS; PPS1; VWS; VWS1
Target Background
This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
