Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITGA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human ITGA1 (NP_852478.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITGA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human ITGA1 (NP_852478.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04665A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITGA1 |
| Target Synonyms | VLA1; CD49a; ITGA1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ITGA1 (NP_852478.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATVCFDVKLKSKEDTIYEADLQYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFNLTDPENGPVLDDSLPNSVHE | Uniprot ID | P56199 |
Uniprot Id
P56199
Target Species
Human
Target Name
ITGA1
Target Full Name
Integrin alpha-1
Target Function
Integrin alpha-1/beta-1 is a receptor for laminin and collagen. It recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. Involved in anchorage-dependent, negative regulation of EGF-stimulated cell growth.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Integrin alpha chain family
Target Synonyms
CD 49a; CD49 antigen-like family member A; CD49a; CD49a antigen; Integrin alpha-1; ITA1_HUMAN; Itga 1; ITGA1; Laminin and collagen receptor; Very late activation protein 1; VLA 1; VLA-1; VLA1
Target Background
This gene encodes the alpha 1 subunit of integrin receptors. This protein heterodimerizes with the beta 1 subunit to form a cell-surface receptor for collagen and laminin. The heterodimeric receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. The alpha 1 subunit contains an inserted (I) von Willebrand factor type I domain which is thought to be involved in collagen binding.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
