Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITSN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-620 of human ITSN2 (NP_006268.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ITSN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-620 of human ITSN2 (NP_006268.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00236A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITSN2 |
| Target Synonyms | SWA; SWAP; SH3D1B; SH3P18; PRO2015; ITSN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, LO2, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 500-620 of human ITSN2 (NP_006268.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLDALEKETASKLSEMDSFNNQL | Uniprot ID | Q9NZM3 |
Uniprot Id
Q9NZM3
Target Species
Human
Target Name
ITSN2
Target Full Name
Intersectin-2
Target Function
Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles (CCPs). Seems to be involved in CCPs maturation including invagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR). Plays a role in dendrite formation by melanocytes.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Expressed in melanocytes. Ubiquitous. Isoform 1 is primarily expressed in adult heart and liver.
Target Synonyms
ITSN2; KIAA1256; SH3D1B; SWAP; Intersectin-2; SH3 domain-containing protein 1B; SH3P18; SH3P18-like WASP-associated protein
Target Background
This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may function in the induction of T cell antigen receptor (TCR) endocytosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
