-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KANK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human KANK1 (NP_055973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against KANK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human KANK1 (NP_055973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-05815A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KANK1 |
| Target Synonyms | KANK; CPSQ2; ANKRD15; KANK1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human KANK1 (NP_055973.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGIN | Uniprot ID | Q14678 |
Uniprot Id
Q14678
Target Species
Human
Target Name
KANK1
Target Full Name
KN motif and ankyrin repeat domain-containing protein 1
Target Function
Involved in the control of cytoskeleton formation by regulating actin polymerization. Inhibits actin fiber formation and cell migration. Inhibits RhoA activity; the function involves phosphorylation through PI3K/Akt signaling and may depend on the competetive interaction with 14-3-3 adapter proteins to sequester them from active complexes. Inhibits the formation of lamellipodia but not of filopodia; the function may depend on the competetive interaction with BAIAP2 to block its association with activated RAC1. Inhibits fibronectin-mediated cell spreading; the function is partially mediated by BAIAP2. Inhibits neurite outgrowth. Involved in the establishment and persistence of cell polarity during directed cell movement in wound healing. In the nucleus, is involved in beta-catenin-dependent activation of transcription. Potential tumor suppressor for renal cell carcinoma. Regulates Rac signaling pathways.
Target Involvement
Cerebral palsy, spastic quadriplegic 2 (CPSQ2)
Target Subcellular Location
Cell projection, ruffle membrane. Cytoplasm. Nucleus.; [Isoform 1]: Cytoplasm. Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.
Target Tissue Specificity
Widely expressed. Isoform 1 is predominantly expressed in heart and kidney. Isoform 2 probably is widely expressed at basic levels.
Target Synonyms
ANKRD 15; Ankyrin repeat domain 15; Ankyrin repeat domain containing protein 15; Ankyrin repeat domain-containing protein 15; DKFZp451G231; KANK; KANK1; KANK1_HUMAN; KIAA0172; Kidney ankyrin repeat containing protein; Kidney ankyrin repeat-containing protein; KN motif and ankyrin repeat domain-containing protein 1; MGC43128
Target Background
The protein encoded by this gene belongs to the Kank family of proteins, which contain multiple ankyrin repeat domains. This family member functions in cytoskeleton formation by regulating actin polymerization. This gene is a candidate tumor suppressor for renal cell carcinoma. Mutations in this gene cause cerebral palsy spastic quadriplegic type 2, a central nervous system development disorder. A t(5;9) translocation results in fusion of the platelet-derived growth factor receptor beta gene (PDGFRB) on chromosome 5 with this gene in a myeloproliferative neoplasm featuring severe thrombocythemia. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 20.
Notification