-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNAB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 282-401 of human KCNAB1 (NP_751891.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNAB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 282-401 of human KCNAB1 (NP_751891.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05129A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNAB1 |
| Target Synonyms | hKvb3; AKR6A3; KCNA1B; Kvb1.3; hKvBeta3; KV-BETA-1; KCNAB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, 293T, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 282-401 of human KCNAB1 (NP_751891.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS | Uniprot ID | Q14722 |
Uniprot Id
Q14722
Target Species
Human
Target Name
KCNAB1
Target Full Name
Voltage-gated potassium channel subunit beta-1
Target Function
Cytoplasmic potassium channel subunit that modulates the characteristics of the channel-forming alpha-subunits. Modulates action potentials via its effect on the pore-forming alpha subunits. Promotes expression of the pore-forming alpha subunits at the cell membrane, and thereby increases channel activity. Mediates closure of delayed rectifier potassium channels by physically obstructing the pore via its N-terminal domain and increases the speed of channel closure for other family members. Promotes the closure of KCNA1, KCNA2 and KCNA5 channels. Accelerates KCNA4 channel closure. Accelerates the closure of heteromeric channels formed by KCNA1 and KCNA4. Accelerates the closure of heteromeric channels formed by KCNA2, KCNA5 and KCNA6. Isoform KvB1.2 has no effect on KCNA1, KCNA2 or KCNB1. Enhances KCNB1 and KCNB2 channel activity. Binds NADPH; this is required for efficient down-regulation of potassium channel activity. Has NADPH-dependent aldoketoreductase activity. Oxidation of the bound NADPH strongly decreases N-type inactivation of potassium channel activity.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Shaker potassium channel beta subunit family
Target Tissue Specificity
In brain, expression is most prominent in caudate nucleus, hippocampus and thalamus. Significant expression also detected in amygdala and subthalamic nucleus. Also expressed in both healthy and cardiomyopathic heart. Up to four times more abundant in left
Target Synonyms
hKvb3; hKvBeta3; K(+) channel subunit beta-1; KCAB1_HUMAN; KCNA1B; KCNAB1; Kv-beta-1; Kvb1.3; Voltage-gated potassium channel beta-1 subunit; Voltage-gated potassium channel subunit beta-1
Target Background
Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member includes distinct isoforms which are encoded by alternatively spliced transcript variants of this gene. Some of these isoforms are beta subunits, which form heteromultimeric complexes with alpha subunits and modulate the activity of the pore-forming alpha subunits.
Notification