-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-90 of human KCNK4 (NP_201567.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-90 of human KCNK4 (NP_201567.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02249A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNK4 |
| Target Synonyms | FHEIG; TRAAK; K2p4.1; TRAAK1; KCNK4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-90 of human KCNK4 (NP_201567.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSAWDL | Uniprot ID | Q9NYG8 |
Uniprot Id
Q9NYG8
Target Species
Human
Target Name
KCNK4
Target Full Name
Potassium channel subfamily K member 4
Target Function
Voltage-insensitive potassium channel. Channel opening is triggered by mechanical forces that deform the membrane. Channel opening is triggered by raising the intracellular pH to basic levels. The channel is inactive at 24 degrees Celsius (in vitro); raising the temperature to 37 degrees Celsius increases the frequency of channel opening, with a further increase in channel activity when the temperature is raised to 42 degrees Celsius. Plays a role in the perception of pain caused by heat. Plays a role in the sensory perception of pain caused by pressure.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Target Synonyms
KCNK4; TRAAK; Potassium channel subfamily K member 4; TWIK-related arachidonic acid-stimulated potassium channel protein; Two pore potassium channel KT4.1; Two pore K(+ channel KT4.1
Target Background
This gene encodes a member of the TWIK-related arachidonic acid-stimulated two pore potassium channel subfamily. The encoded protein homodimerizes and functions as an outwardly rectifying channel. This channel is regulated by polyunsaturated fatty acids, temperature and mechanical deformation of the lipid membrane. This protein is expressed primarily in neural tissues and may be involved in regulating the noxious input threshold in dorsal root ganglia neurons. Alternate splicing results in multiple transcript variants. Naturally occurring read-through transcripts also exist between this gene and the downstream testis expressed 40 (TEX40) gene, as represented in GeneID: 106780802.
Notification