Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNK6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 254-313 of human KCNK6 (NP_004814.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNK6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 254-313 of human KCNK6 (NP_004814.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04647A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNK6 |
| Target Synonyms | TOSS; KCNK8; TWIK2; K2p6.1; TWIK-2; KCNK6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, 293T, A-549, BxPC-3, HT-29, K-562, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 254-313 of human KCNK6 (NP_004814.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDYASIPR | Uniprot ID | Q9Y257 |
Uniprot Id
Q9Y257
Target Species
Human
Target Name
KCNK6
Target Full Name
Potassium channel subfamily K member 6
Target Function
Exhibits outward rectification in a physiological K(+) gradient and mild inward rectification in symmetrical K(+) conditions.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Target Tissue Specificity
Widespread expression, detected in all tissues tested except for skeletal muscle. Strongest expression in placenta, pancreas, heart, colon and spleen, lower levels detected in peripheral blood leukocytes, lung, liver, kidney and thymus. Lowest expression
Target Synonyms
KCNK6; TOSS; TWIK2; Potassium channel subfamily K member 6; Inward rectifying potassium channel protein TWIK-2; TWIK-originated similarity sequence
Target Background
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
