-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCNMB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-102 of human KCNMB1 (NP_004128.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCNMB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-102 of human KCNMB1 (NP_004128.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06465A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCNMB1 |
| Target Synonyms | hbeta1; BKbeta1; SLO-BETA; hslo-beta; K(VCA)beta; slo-beta-1; k(VCA)beta-1; KCNMB1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, THP-1, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-102 of human KCNMB1 (NP_004128.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQ | Uniprot ID | Q16558 |
Uniprot Id
Q16558
Target Species
Human
Target Name
KCNMB1
Target Full Name
Calcium-activated potassium channel subunit beta-1
Target Function
Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
KCNMB (TC 8.A.14.1) family, KCNMB1 subfamily
Target Tissue Specificity
Abundantly expressed in smooth muscle. Low levels of expression in most other tissues. Within the brain, relatively high levels found in hippocampus and corpus callosum.
Target Synonyms
BK channel beta subunit; BK channel subunit beta 1; BK channel subunit beta-1; BKbeta; BKbeta1; Calcium activated potassium channel subfamily M subunit beta 1; Calcium activated potassium channel subunit beta 1; Calcium activated potassium channel subunit beta; Calcium-activated potassium channel; Calcium-activated potassium channel subunit beta; Calcium-activated potassium channel subunit beta-1; Charybdotoxin receptor subunit beta 1; Charybdotoxin receptor subunit beta-1; Hbeta1; hslo beta; K(VCA)beta 1; K(VCA)beta; K(VCA)beta-1; KCMB1_HUMAN; KCNMB 1; Kcnmb1; Large conductance Ca2+ activated K+ channel beta 1 subunit; Maxi K channel beta subunit; Maxi K channel subunit beta 1; Maxi K channel subunit beta-1; Potassium large conductance calcium activated channel subfamily M beta member 1; Slo beta 1; SLO beta; Slo-beta; Slo-beta-1; subfamily M subunit beta-1
Target Background
MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the product of this gene, the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.
Notification