Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KCTD10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human KCTD10 (NP_114160.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KCTD10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human KCTD10 (NP_114160.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09227A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KCTD10 |
| Target Synonyms | BTBD28; ULRO61; MSTP028; hBACURD3; KCTD10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, MCF7, Mouse brain, Mouse thymus, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human KCTD10 (NP_114160.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTDSEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKVPVITSSKEEQKLIATSNKPA | Uniprot ID | Q9H3F6 |
Uniprot Id
Q9H3F6
Target Species
Human
Target Name
KCTD10
Target Full Name
BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3
Target Function
Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex. The BCR(BACURD3) E3 ubiquitin ligase complex mediates the ubiquitination of target proteins, leading to their degradation by the proteasome.
Target Subcellular Location
Nucleus.
Target Protein Families
BACURD family
Target Synonyms
KCTD10; ULR061; MSTP028BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3; hBACURD3; BTB/POZ domain-containing protein KCTD10; Potassium channel tetramerization domain-containing protein 10
Target Background
The protein encoded by this gene binds proliferating cell nuclear antigen (PCNA) and may be involved in DNA synthesis and cell proliferation. In addition, the encoded protein may be a tumor suppressor. Several protein-coding and non-protein coding transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
