-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KDM2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KDM2A (NP_036440.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KDM2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KDM2A (NP_036440.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10576A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KDM2A |
| Target Synonyms | FBL7; CXXC8; FBL11; FBXL11; JHDM1A; LILINA; KDM2A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BT-474, Jurkat, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KDM2A (NP_036440.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKM | Uniprot ID | Q9Y2K7 |
Uniprot Id
Q9Y2K7
Target Species
Human
Target Name
KDM2A
Target Full Name
Lysine-specific demethylase 2A
Target Function
Histone demethylase that specifically demethylates 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. May also recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Required to maintain the heterochromatic state. Associates with centromeres and represses transcription of small non-coding RNAs that are encoded by the clusters of satellite repeats at the centromere. Required to sustain centromeric integrity and genomic stability, particularly during mitosis. Regulates circadian gene expression by repressing the transcriptional activator activity of CLOCK-ARNTL/BMAL1 heterodimer and RORA in a catalytically-independent manner
Target Subcellular Location
Nucleus, nucleoplasm. Note=Punctate expression throughout the nucleoplasm and enriched in the perinucleolar region. Specifically nucleates at CpG islands where it's presence results in chromatin depleted in H3K36me2.
Target Protein Families
JHDM1 histone demethylase family
Target Tissue Specificity
Widely expressed, with highest levels in brain, testis and ovary, followed by lung.
Target Synonyms
[Histone-H3]-lysine-36 demethylase 1A; CXXC-type zinc finger protein 8; CXXC8; F box / LRR repeat protein 11; F box and leucine rich repeat protein 11; F box protein FBL7; F-box and leucine-rich repeat protein 11; F-box protein FBL7; F-box protein Lilina; F-box/LRR-repeat protein 11; FBL11; FBL7; FBXL11; JHDM1A; JmjC domain-containing histone demethylation protein 1A; Jumonji C domain containing histone demethylase 1A ; kdm2a; KDM2A_HUMAN; LILINA; Lysine (K) specific demethylase 2A; Lysine-specific demethylase 2A
Target Background
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least six highly degenerated leucine-rich repeats. This family member plays a role in epigenetic silencing. It nucleates at CpG islands and specifically demethylates both mono- and di-methylated lysine-36 of histone H3. Alternative splicing results in multiple transcript variants.
Notification