Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human KLF9 (NP_001197.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLF9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human KLF9 (NP_001197.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12703A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF9 |
| Target Synonyms | BTEB; BTEB1; KLF9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, HepG2, K-562, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human KLF9 (NP_001197.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGC | Uniprot ID | Q13886 |
Uniprot Id
Q13886
Target Species
Human
Target Name
KLF9
Target Full Name
Krueppel-like factor 9
Target Function
Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box. Acts as an epidermal circadian transcription factor regulating keratinocyte proliferation.
Target Subcellular Location
Nucleus.
Target Protein Families
Sp1 C2H2-type zinc-finger protein family
Target Tissue Specificity
Epidermis (at protein level).
Target Synonyms
Basic transcription element binding protein 1; Basic transcription element-binding protein 1; BTE binding protein 1; BTE-binding protein 1; BTEB 1; BTEB; BTEB1; GC box binding protein 1; GC-box-binding protein 1; KLF 9; KLF9; KLF9_HUMAN; Krueppel like factor 9 ; Krueppel-like factor 9; Transcription factor BTEB 1; Transcription factor BTEB1
Target Background
The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
