-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KMT5C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KMT5C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13532A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KMT5C |
| Target Synonyms | SUV420H2; Suv4-20h2; 5C | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC | Uniprot ID | Q86Y97 |
Uniprot Id
Q86Y97
Target Species
Human
Target Name
KMT5C
Target Full Name
Histone-lysine N-methyltransferase KMT5C
Target Function
Histone methyltransferase that specifically methylates monomethylated 'Lys-20' (H4K20me1) and dimethylated 'Lys-20' (H4K20me2) of histone H4 to produce respectively dimethylated 'Lys-20' (H4K20me2) and trimethylated 'Lys-20' (H4K20me3) and thus regulates transcription and maintenance of genome integrity. In vitro also methylates unmodified 'Lys-20' (H4K20me0) of histone H4 and nucleosomes. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. KMT5C is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Facilitates TP53BP1 foci formation upon DNA damage and proficient non-homologous end-joining (NHEJ)-directed DNA repair by catalyzing the di- and trimethylation of 'Lys-20' of histone H4. May play a role in class switch reconbination by catalyzing the di- and trimethylation of 'Lys-20' of histone H4.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, Suvar4-20 subfamily
Target Synonyms
FLJ98627; Histone lysine N methyltransferase SUV420H2; Histone-lysine N-methyltransferase SUV420H2; KMT5C; Lysine N methyltransferase 5C; Lysine N-methyltransferase 5C; MGC2705; Su(var)4 20 homolog 2; Su(var)4-20 homolog 2; Suppressor of variegation 4 20 homolog 2; Suppressor of variegation 4-20 homolog 2; Suv4 20h2; Suv4-20h2; SUV420H2; SV422_HUMAN
Target Background
SUV420H2 and the related enzyme SUV420H1 (MIM 610881) function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 (see MIM 602822) on lysine-20 (K20) (Schotta et al., 2004 [PubMed 15145825]).
Notification