Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human LAD1 (NP_005549.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LAD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human LAD1 (NP_005549.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06901A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAD1 |
| Target Synonyms | LadA; LAD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-200 of human LAD1 (NP_005549.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TTDDEAPRLSQNGDRQASASERLPSVEEAEVPKPLPPASKDEDEDIQSILRTRQERRQRRQVVEAAQAPIQERLEAEEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKT | Uniprot ID | O00515 |
Uniprot Id
O00515
Target Species
Human
Target Name
LAD1
Target Full Name
Ladinin-1
Target Function
Anchoring filament protein which is a component of the basement membrane zone.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane.
Target Synonyms
LAD ; Lad 1; Lad-1; Lad1; LAD1_HUMAN; LADA; Ladinin 1 ; Ladinin-1; Linear IgA bullous dermatosis antigen ; Linear IgA disease antigen; Linear IgA disease antigen homolog; MGC10355
Target Background
The protein encoded by this gene may be an anchoring filament that is a component of basement membranes. It may contribute to the stability of the association of the epithelial layers with the underlying mesenchyme.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
