Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LETM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human LETM1 (NP_036450.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LETM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human LETM1 (NP_036450.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04902A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LETM1 |
| Target Synonyms | Mdm38; CONDMIM; SLC55A1; LETM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat brain, A-431, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human LETM1 (NP_036450.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHPVYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSLKDKNKKLEEGGPV | Uniprot ID | O95202 |
Uniprot Id
O95202
Target Species
Human
Target Name
LETM1
Target Full Name
Mitochondrial proton/calcium exchanger protein
Target Function
Mitochondrial proton/calcium antiporter that mediates proton-dependent calcium efflux from mitochondrion. Crucial for the maintenance of mitochondrial tubular networks and for the assembly of the supercomplexes of the respiratory chain. Required for the maintenance of the tubular shape and cristae organization. In contrast to SLC8B1/NCLX, does not constitute the major factor for mitochondrial calcium extrusion.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
LETM1 family
Target Synonyms
LETM1; Mitochondrial proton/calcium exchanger protein; Leucine zipper-EF-hand-containing transmembrane protein 1
Target Background
This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
