-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LGR6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 735-835 of human LGR6 (NP_001017403.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LGR6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 735-835 of human LGR6 (NP_001017403.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05807A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LGR6 |
| Target Synonyms | GPCR; VTS20631; LGR6 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 735-835 of human LGR6 (NP_001017403.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIFADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFR | Uniprot ID | Q9HBX8 |
Uniprot Id
Q9HBX8
Target Species
Human
Target Name
LGR6
Target Full Name
Leucine-rich repeat-containing G-protein coupled receptor 6
Target Function
Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a marker of multipotent stem cells in the epidermis. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. May act as a tumor suppressor.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Research Area
Signal Transduction
Target Synonyms
FLJ14471; Gonadotropin receptor; GPCR; Leucine rich repeat containing G protein coupled receptor 6; Leucine-rich repeat-containing G-protein coupled receptor 6; Lgr6; LGR6_HUMAN; VTS20631
Target Background
This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leucine-rich repeats important for the formation of a horseshoe-shaped interaction motif for ligand binding. Alternative splicing of this gene results in multiple transcript variants.
Notification