Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LHX9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LHX9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03205A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LHX9 |
| Target Synonyms | LHX9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse ovary, Mouse testis, Rat testis, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPAL | Uniprot ID | Q9NQ69 |
Uniprot Id
Q9NQ69
Target Species
Human
Target Name
LHX9
Target Full Name
LIM/homeobox protein Lhx9
Target Function
Involved in gonadal development.
Target Subcellular Location
Nucleus.
Target Synonyms
LHX 9; lhx9; LHX9_HUMAN; LIM homeobox 9; LIM homeobox 9 protein; LIM homeobox protein 9; LIM homeodomain type transcription factor; LIM homeodomain type transcription factor Lhx9; LIM/homeobox protein Lhx9
Target Background
This gene encodes a member of the LIM homeobox gene family of developmentally expressed transcription factors. The encoded protein contains a homeodomain and two cysteine-rich zinc-binding LIM domains involved in protein-protein interactions. The protein is highly similar to a mouse protein that causes gonadal agenesis when inactivated, suggesting a role in gonadal development. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
