-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LIMA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 560-759 of human LIMA1 (NP_057441.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against LIMA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 560-759 of human LIMA1 (NP_057441.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09214A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LIMA1 |
| Target Synonyms | EPLIN; LDLCQ8; SREBP3; LIMA1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 560-759 of human LIMA1 (NP_057441.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQSTSVKSPKTVSPPIRKGWSMSEQSEESVGGRVAERKQVENAKASKKNGNVGKTTWQNKESKGETGKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQEPKSLNWSSFVDNTFAEEFTTQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE | Uniprot ID | Q9UHB6 |
Uniprot Id
Q9UHB6
Target Species
Human
Target Name
LIMA1
Target Full Name
LIM domain and actin-binding protein 1
Target Function
Actin-binding protein involved in actin cytoskeleton regulation and dynamics. Increases the number and size of actin stress fibers and inhibits membrane ruffling. Inhibits actin filament depolymerization. Bundles actin filaments, delays filament nucleation and reduces formation of branched filaments. Plays a role in cholesterol homeostasis. Influences plasma cholesterol levels through regulation of intestinal cholesterol absorption. May act as a scaffold protein by regulating NPC1L1 transportation, an essential protein for cholesterol absorption, to the plasma membrane by recruiting MYO5B to NPC1L1, and thus facilitates cholesterol uptake.
Target Subcellular Location
Cytoplasm. Cell junction, focal adhesion. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, stress fiber. Cell membrane.
Target Tissue Specificity
Highly expressed in placenta, kidney, pancreas, prostate, ovary, spleen and heart. Also detected in lung, liver, brain, skeletal muscle, thymus, testis and intestine. Not detected in leukocytes. Isoform Beta expressed generally at very low levels. Isoform
Target Synonyms
1110021C24Rik; Epithelial protein lost in neoplasm; Epithelial protein lost in neoplasm beta; EPLIN; FLJ38853; LIM domain and actin binding 1; LIM domain and actin binding protein 1 ; LIM domain and actin-binding protein 1; LIMA1; LIMA1_HUMAN; MGC131726; SREBP3; Sterol regulatory element binding protein 3
Target Background
This gene encodes a cytoskeleton-associated protein that inhibits actin filament depolymerization and cross-links filaments in bundles. It is downregulated in some cancer cell lines. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and expression of some of the variants maybe independently regulated.
Notification