Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LMAN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-320 of human LMAN2 (NP_006807.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LMAN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-320 of human LMAN2 (NP_006807.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05091A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LMAN2 |
| Target Synonyms | GP36B; VIP36; C5orf8; LMAN2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 190-320 of human LMAN2 (NP_006807.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTG | Uniprot ID | Q12907 |
Uniprot Id
Q12907
Target Species
Human
Target Name
LMAN2
Target Full Name
Vesicular integral-membrane protein VIP36
Target Function
Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
Target Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Ubiquitous.
Target Research Area
Signal Transduction
Target Synonyms
C5orf8; Glycoprotein GP36b; GP36B; Lectin mannose-binding 2; Lectin, mannose binding 2; LMAN 2; LMAN2; LMAN2_HUMAN; Vesicular integral membrane protein VIP36; Vesicular integral-membrane protein 36; Vesicular integral-membrane protein VIP36; VIP36
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
