-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LMAN2L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 189-348 of human LMAN2L (NP_110432.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LMAN2L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 189-348 of human LMAN2L (NP_110432.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07306A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LMAN2L |
| Target Synonyms | VIPL; MRD69; MRT52; LMAN2L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 189-348 of human LMAN2L (NP_110432.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY | Uniprot ID | Q9H0V9 |
Uniprot Id
Q9H0V9
Target Species
Human
Target Name
LMAN2L
Target Full Name
VIP36-like protein
Target Function
May be involved in the regulation of export from the endoplasmic reticulum of a subset of glycoproteins. May function as a regulator of ERGIC-53.
Target Involvement
Mental retardation, autosomal recessive 52 (MRT52)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Note=Predominantly found in the endoplasmic reticulum. Partly found in the Golgi.
Target Tissue Specificity
Expressed in numerous tissues. Highest expression in skeletal muscle and kidney, intermediate levels in heart, liver and placenta, low levels in brain, thymus, spleen, small intestine and lung.
Target Synonyms
LMAN2L; VIPL; PSEC0028; UNQ368/PRO704; VIP36-like protein; Lectin mannose-binding 2-like; LMAN2-like protein
Target Background
This gene encodes a protein belonging to the L-type lectin group of type 1 membrane proteins, which function in the mammalian early secretory pathway. These proteins contain luminal carbohydrate recognition domains, which display homology to leguminous lectins. Unlike other proteins of the group, which cycle in the early secretory pathway and are predominantly associated with post endoplasmic reticulum membranes, the protein encoded by this gene is a non-cycling resident protein of the ER, where it functions as a cargo receptor for glycoproteins. It is proposed to regulate exchange of folded proteins for transport to the Golgi and exchange of misfolded glycoproteins for transport to the ubiquitin-proteasome pathway.
Notification