Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LMO4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human LMO4 (NP_006760.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against LMO4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human LMO4 (NP_006760.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of MCF-7 cells using LMO4 antibody. Blue: DAPI for nuclear staining.
| Cat.No | ADA-02603A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LMO4 |
| Target Synonyms | LMO4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human LMO4 (NP_006760.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC | Uniprot ID | P61968 |
Uniprot Id
P61968
Target Species
Human
Target Name
LMO4
Target Full Name
LIM domain transcription factor LMO4
Target Function
Probable transcriptional factor.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Breast tumor autoantigen; LIM domain only 4; LIM domain only protein 4; LIM domain transcription factor LMO 4; LIM domain transcription factor LMO4; LMO 4; LMO-4; LMO4; LMO4_HUMAN; OTTHUMP00000011905; OTTHUMP00000011906
Target Background
This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
