-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LSAMP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 219-315 of human LSAMP (NP_002329.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LSAMP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 219-315 of human LSAMP (NP_002329.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05776A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LSAMP |
| Target Synonyms | LAMP; IGLON3; LSAMP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 219-315 of human LSAMP (NP_002329.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN | Uniprot ID | Q13449 |
Uniprot Id
Q13449
Target Species
Human
Target Name
LSAMP
Target Full Name
Limbic system-associated membrane protein
Target Function
Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Immunoglobulin superfamily, IgLON family
Target Tissue Specificity
Expressed on limbic neurons and fiber tracts as well as in single layers of the superior colliculus, spinal chord and cerebellum.
Target Synonyms
IgLON family member 3; IGLON3; Lam; LAMP; Limbic system associated membrane protein ; Limbic system associated membrane protein precursor ; Limbic system-associated membrane protein; LSAMP; LSAMP_HUMAN
Target Background
This gene encodes a member of the immunoglobulin LAMP, OBCAM and neurotrimin (IgLON) family of proteins. The encoded preproprotein is proteolytically processed to generate a neuronal surface glycoprotein. This protein may act as a selective homophilic adhesion molecule during axon guidance and neuronal growth in the developing limbic system. The encoded protein may also function as a tumor suppressor and may play a role in neuropsychiatric disorders. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
Notification