Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAP4K3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 755-894 of human MAP4K3 (NP_003609.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAP4K3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 755-894 of human MAP4K3 (NP_003609.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02562A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAP4K3 |
| Target Synonyms | GLK; MEKKK3; MEKKK 3; MAPKKKK3; RAB8IPL1; MAP4K3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Rat heart, 293T, HepG2, MCF7, Mouse brain, Mouse lung, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 755-894 of human MAP4K3 (NP_003609.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY | Uniprot ID | Q8IVH8 |
Uniprot Id
Q8IVH8
Target Species
Human
Target Name
MAP4K3
Target Full Name
Mitogen-activated protein kinase kinase kinase kinase 3
Target Function
May play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Tissue Specificity
Ubiquitously expressed in all tissues examined, with high levels in heart, brain, placenta, skeletal muscle, kidney and pancreas and lower levels in lung and liver.
Target Synonyms
MAP4K3; RAB8IPL1Mitogen-activated protein kinase kinase kinase kinase 3; EC 2.7.11.1; Germinal center kinase-related protein kinase; GLK; MAPK/ERK kinase kinase kinase 3; MEK kinase kinase 3; MEKKK 3
Target Background
This gene encodes a member of the mitogen-activated protein kinase kinase kinase kinase family. The encoded protein activates key effectors in cell signalling, among them c-Jun. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
