-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAPKBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPKBP1 (NP_001122080.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MAPKBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPKBP1 (NP_001122080.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04313A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAPKBP1 |
| Target Synonyms | JNKBP1; NPHP20; JNKBP-1; MAPKBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAPKBP1 (NP_001122080.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVEGSTITSRIKNLLRSPSIKLRRSKAGNRREDLSSKVTLEKVLGITVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSP | Uniprot ID | O60336 |
Uniprot Id
O60336
Target Species
Human
Target Name
MAPKBP1
Target Full Name
Mitogen-activated protein kinase-binding protein 1
Target Function
Negative regulator of NOD2 function. It down-regulates NOD2-induced processes such as activation of NF-kappa-B signaling, IL8 secretion and antibacterial response. Involved in JNK signaling pathway.
Target Involvement
Nephronophthisis 20 (NPHP20)
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, spindle pole.
Target Tissue Specificity
Expressed in intestinal mucosa, where it is detected in epithelial cells, endothelial cells, smooth muscle cells and immune cells, such as lymphocytes. Expressed in kidney.
Target Synonyms
JNK binding protein 1; JNK-binding protein 1; JNKBP-1; JNKBP1; KIAA0596; MABP1_HUMAN; MAPKBP 1; mapkbp1; Mitogen activated protein kinase binding protein 1; Mitogen-activated protein kinase-binding protein 1
Target Background
This gene encodes a scaffold protein that regulates the JNK (c-Jun N-terminal kinase) and NOD2 (nucleotide-binding oligomerization domain-containing protein 2) signaling pathways. The encoded protein interacts with another related JNK pathway scaffold protein, WDR62, via a conserved dimerization domain, and enhances JNK signaling. This protein may play a role in bacterial immunity by binding to the NOD2 receptor and negatively regulating downstream antibacterial and pro-inflammatory signaling. Mutations in this gene that impair cellular localization of the encoded protein cause a form of nephronophthisis, an autosomal-recessive kidney disorder, in human patients.
Notification