-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARCKSL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human MARCKSL1 (NP_075385.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MARCKSL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human MARCKSL1 (NP_075385.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02665A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MARCKSL1 |
| Target Synonyms | F52; MLP; MRP; MLP1; MACMARCKS; MARCKSL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 22Rv1, BT-474, HT-29, Mouse spleen, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human MARCKSL1 (NP_075385.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE | Uniprot ID | P49006 |
Uniprot Id
P49006
Target Species
Human
Target Name
MARCKSL1
Target Full Name
MARCKS-related protein
Target Function
Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration. When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration. May be involved in coupling the protein kinase C and calmodulin signal transduction systems.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell membrane; Lipid-anchor.
Target Protein Families
MARCKS family
Target Research Area
Signal Transduction
Target Synonyms
F52; Mac MARCKS ; Mac-MARCKS; MacMARCKS; Macrophage enriched Myristoylated Alanine Rich C Kinase Substrate Like Protein; Macrophage myristoylated alanine-rich C kinase substrate; MARCKS like 1; MARCKS like protein 1; MARCKS related protein ; MARCKS-like protein 1; MARCKS-related protein; MARCKSL1; MLP; MLP1; MRP; MRP_HUMAN
Target Background
This gene encodes a member of the myristoylated alanine-rich C-kinase substrate (MARCKS) family. Members of this family play a role in cytoskeletal regulation, protein kinase C signaling and calmodulin signaling. The encoded protein affects the formation of adherens junction. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on the long arm of chromosomes 6 and 10.
Notification