Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MBD3L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human MBD3L1 (NP_660209.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MBD3L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human MBD3L1 (NP_660209.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02158A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MBD3L1 |
| Target Synonyms | MBD3L; MBD3L1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human MBD3L1 (NP_660209.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEKR | Uniprot ID | Q8WWY6 |
Uniprot Id
Q8WWY6
Target Species
Human
Target Name
MBD3L1
Target Full Name
Methyl-CpG-binding domain protein 3-like 1
Target Function
Transcriptional repressor.
Target Subcellular Location
Nucleus. Note=Nuclear, in large foci.
Target Protein Families
MBD3L family
Target Tissue Specificity
Highly expressed in testis. Detected at low levels in pancreas. Not detected in the other tissues tested.
Target Synonyms
MB3L1_HUMAN; MBD3 like 1 ; MBD3-like protein 1; MBD3L ; Mbd3l1; Methyl CpG binding domain protein 3 like 1; Methyl-CpG-binding domain protein 3-like 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
