Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MC2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MC2R (NP_000520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MC2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MC2R (NP_000520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04211A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MC2R |
| Target Synonyms | ACTHR; MC2R | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MC2R (NP_000520.1) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFET | Uniprot ID | Q01718 |
Uniprot Id
Q01718
Target Species
Human
Target Name
MC2R
Target Full Name
Adrenocorticotropic hormone receptor
Target Function
Receptor for corticotropin (ACTH). This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase (cAMP).
Target Involvement
Glucocorticoid deficiency 1 (GCCD1)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Melanocytes and corticoadrenal tissue.
Target Synonyms
ACTHR; MC2R
Target Background
MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
