-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against MCM3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-13760A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCM3 |
| Target Synonyms | HCC5; P1.h; RLFB; P1-MCM3; MCM3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, K-562, Mouse spleen | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV | Uniprot ID | P25205 |
Uniprot Id
P25205
Target Species
Human
Target Name
MCM3
Target Full Name
DNA replication licensing factor MCM3
Target Function
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for DNA replication and cell proliferation.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
MCM family
Target Synonyms
Cervical cancer proto oncogene 5; DNA polymerase alpha holoenzyme associated P1; DNA polymerase alpha holoenzyme associated protein P1; DNA polymerase alpha holoenzyme-associated protein P1; DNA replication factor MCM3; DNA replication licensing factor mcm3; HCC 5; HCC5; hRlf beta subunit; Human cervical cancer proto oncogene 5; MCM 3; mcm3; MCM3 minichromosome maintenance deficient 3; MCM3_HUMAN; MGC1157; Minichromosome maintenance complex component 3; Minichromosome maintenance deficient 3; Minichromosome maintenance protein 3; P1 h; P1 MCM3; P1 Protein; P1-MCM3; P1.h; p102; P102 protein; Replication licensing factor beta subunit; RLF beta subunit; RLF subunit beta; RLFB
Target Background
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Several transcript variants encoding different isoforms have been found for this gene.
Notification