-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MDC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MDC1 (NP_055456.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MDC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MDC1 (NP_055456.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03202A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MDC1 |
| Target Synonyms | NFBD1; MDC1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MDC1 (NP_055456.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQI | Uniprot ID | Q14676 |
Uniprot Id
Q14676
Target Species
Human
Target Name
MDC1
Target Full Name
Mediator of DNA damage checkpoint protein 1
Target Function
Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.
Target Subcellular Location
Nucleus. Chromosome. Note=Associated with chromatin. Relocalizes to discrete nuclear foci following DNA damage, this requires 'Ser-139' phosphorylation of H2AX. Colocalizes with APTX at sites of DNA double-strand breaks.
Target Tissue Specificity
Highly expressed in testis.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Homologue to Drosophila photoreceptor protein calphotin; MDC 1; Mdc1; MDC1_HUMAN; Mediation of DNA damage checkpoint 1; Mediator of DNA damage checkpoint 1; Mediator of DNA damage checkpoint protein 1; NFBD 1; NFBD1; Nuclear factor with BRCT domains 1; Nuclear Factor with BRCT Domains Protein 1
Target Background
The protein encoded by this gene contains an N-terminal forkhead domain, two BRCA1 C-terminal (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence. The encoded protein is required to activate the intra-S phase and G2/M phase cell cycle checkpoints in response to DNA damage. This nuclear protein interacts with phosphorylated histone H2AX near sites of DNA double-strand breaks through its BRCT motifs, and facilitates recruitment of the ATM kinase and meiotic recombination 11 protein complex to DNA damage foci.
Notification