-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MED15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MED15 (NP_001003891.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MED15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MED15 (NP_001003891.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01719A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MED15 |
| Target Synonyms | TIG1; CAG7A; CTG7A; PCQAP; TIG-1; TNRC7; ARC105; MED15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MED15 (NP_001003891.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIG | Uniprot ID | Q96RN5 |
Uniprot Id
Q96RN5
Target Species
Human
Target Name
MED15
Target Full Name
Mediator of RNA polymerase II transcription subunit 15
Target Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for cholesterol-dependent gene regulation. Positively regulates the Nodal signaling pathway.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Mediator complex subunit 15 family
Target Tissue Specificity
Expressed in all tissues examined, including heart, brain, lung, spleen, thymus, pancreas, blood leukocyte and placenta. However, the level of expression varied, with highest expression in the placenta and peripheral blood and lowest in the pancreas and k
Target Synonyms
MED15; ARC105; CTG7A; PCQAP; TIG1; TNRC7; Mediator of RNA polymerase II transcription subunit 15; Activator-recruited cofactor 105 kDa component; ARC105; CTG repeat protein 7a; Mediator complex subunit 15; Positive cofactor 2 glutamine/Q-rich-associated protein; PC2 glutamine/Q-rich-associated protein; TPA-inducible gene 1 protein; TIG-1; Trinucleotide repeat-containing gene 7 protein
Target Background
The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Alternative splicing results in multiple transcript variants.
Notification