-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEPE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-256 of human MEPE (NP_064588.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEPE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-256 of human MEPE (NP_064588.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07204A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEPE |
| Target Synonyms | OF45; MEPE | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, Mouse liver, Mouse spinal cord, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-256 of human MEPE (NP_064588.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FTNRQRLNKEYSISNKENTHNGLRMSIYPKSTGNKGFEDGDDAISKLHDQEEYGAALIRNNMQHIMGPVTAIKLLGEENKENTPRNVLNIIPASMNYAKAHSKDKKKPQRDSQAQKSPVKSKSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGDNDISPFS | Uniprot ID | Q9NQ76 |
Uniprot Id
Q9NQ76
Target Species
Human
Target Name
MEPE
Target Full Name
Matrix extracellular phosphoglycoprotein
Target Function
Promotes renal phosphate excretion and inhibits intestinal phosphate absorption. Promotes bone mineralization by osteoblasts and cartilage mineralization by chondrocytes. Regulates the mineralization of the extracellular matrix of the craniofacial complex, such as teeth, bone and cartilage. Promotes dental pulp stem cell proliferation and differentiation.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Tissue Specificity
Expressed by osteoblasts. Expressed by stem cells in dental pulp. Expressed by mesenchymal cells in dental papilla and dental pulp. Expressed in teeth, specifically in decidious dentin. Expressed in ondotoblasts. Expressed in salivary glands. Secreted fro
Target Synonyms
Matrix extracellular phosphoglycoprotein; MEPE; MEPE_HUMAN; OF45; Osteoblast/osteocyte factor 45
Target Background
This gene encodes a secreted calcium-binding phosphoprotein that belongs to the small integrin-binding ligand, N-linked glycoprotein (SIBLING) family of proteins. Members of this family are components of the extracellular matrix of bone and dentin and regulate bone mineralization. Deficiency of a similar protein in mouse results in increased bone mass. Mice lacking this gene are resistant to aging-related trabecular bone loss. Alternative splicing results in multiple transcript variants.
Notification