Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEX3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MEX3B (NP_115622.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEX3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MEX3B (NP_115622.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00399A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEX3B |
| Target Synonyms | RKHD3; MEX-3B; RNF195; MEX3B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MEX3B (NP_115622.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPSSLFADLERNGSGGGGGGSSGGGETLDDQRALQLALDQLSLLGLDSDEGASLYDSEPRKKSVNMTECV | Uniprot ID | Q6ZN04 |
Uniprot Id
Q6ZN04
Target Species
Human
Target Name
MEX3B
Target Full Name
RNA-binding protein MEX3B
Target Function
RNA-binding protein. May be involved in post-transcriptional regulatory mechanisms.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, P-body. Cytoplasmic granule. Note=Predominantly expressed in the cytoplasm and shuttles between the cytoplasm and the nucleus through the CRM1 export pathway. Localization to P-bodies is dependent on 14-3-3.
Target Tissue Specificity
Highest levels found in fetal brain and testis. Detected in the adult intestinal epithelium, specifically in goblet cell at protein level.
Target Synonyms
MEX3B; KIAA2009; RKHD3; RNF195RNA-binding protein MEX3B; RING finger and KH domain-containing protein 3; RING finger protein 195
Target Background
This gene encodes an RNA-binding phosphoprotein that is part of the MEX3 (muscle excess 3) family of translational regulators. The encoded protein contains N-terminal nuclear export and nuclear localization signals and is exported from the cytoplasm to the nucleus. The protein binds to RNA via two KH domains and also colocalizes with MEX3A, Dcp1A decapping factor and Argonaute proteins within P (processing) bodies.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
