Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MKNK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 374-465 of human MKNK1 (NP_003675.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MKNK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 374-465 of human MKNK1 (NP_003675.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Western blot analysis of various lysates, using MKNK1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.
| Cat.No | ADA-07293A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MKNK1 |
| Target Synonyms | MNK1; MKNK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 374-465 of human MKNK1 (NP_003675.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL | Uniprot ID | Q9BUB5 |
Uniprot Id
Q9BUB5
Target Species
Human
Target Name
MKNK1
Target Full Name
MAP kinase-interacting serine/threonine-protein kinase 1
Target Function
May play a role in the response to environmental stress and cytokines. Appears to regulate translation by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.
Target Subcellular Location
[Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Neuroscience
Target Synonyms
MAP kinase interacting kinase 1; MAP kinase interacting serine/threonine kinase 1; MAP kinase signal integrating kinase 1; MAP kinase signal-integrating kinase 1; MAP kinase-interacting serine/threonine-protein kinase 1; MAPK signal integrating kinase 1; MITOGEN-ACTIVATED PROTEIN KINASE-INTERACTING SERINE/THREONINE KINASE 1; mknk1; MKNK1_HUMAN; MNK 1; Mnk1
Target Background
This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
