-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MMP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 385-477 of human MMP3 (NP_002413.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MMP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 385-477 of human MMP3 (NP_002413.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-17068A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MMP3 |
| Target Synonyms | SL-1; STMY; STR1; CHDS6; MMP-3; STMY1; MMP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, PC-12, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 385-477 of human MMP3 (NP_002413.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC | Uniprot ID | P08254 |
Uniprot Id
P08254
Target Species
Human
Target Name
MMP3
Target Full Name
Stromelysin-1
Target Function
Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase.
Target Involvement
Coronary heart disease 6 (CHDS6)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Peptidase M10A family
Target Research Area
Cancer
Target Synonyms
CHDS6; Matrix metalloproteinase 3; Matrix metalloproteinase 3 preproprotein; Matrix metalloproteinase-3; MGC126102; MGC126103; MGC126104; MMP 3; MMP-3; MMP3; MMP3_HUMAN; Proteoglycanase ; SL-1; SL1 ; STMY; STMY1; STR1; Stromelisin 1; Stromelysin 1; Stromelysin 1 progelatinase; Stromelysin-1; Transin 1; Transin-1
Target Background
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Notification