Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRGPRX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 263-322 of human MRGPRX1 (NP_671732.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRGPRX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 263-322 of human MRGPRX1 (NP_671732.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03459A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRGPRX1 |
| Target Synonyms | GPCR; MGRG2; MRGX1; SNSR4; MRGPRX1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 263-322 of human MRGPRX1 (NP_671732.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ | Uniprot ID | Q96LB2 |
Uniprot Id
Q96LB2
Target Species
Human
Target Name
MRGPRX1
Target Full Name
Mas-related G-protein coupled receptor member X1
Target Function
Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22)(PubMed:26582731). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway. Activated by the antimalarial drug, chloroquine. May mediate chloroquine-induced itch, in a histamine-independent manner.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Mas subfamily
Target Tissue Specificity
Uniquely localized in a subset of small dorsal root and trigeminal sensory neurons.
Target Synonyms
MRGPRX1; MRGX1; SNSR3; SNSR4; Mas-related G-protein coupled receptor member X1; Sensory neuron-specific G-protein coupled receptor 3/4
Target Background
Enables transmembrane signaling receptor activity. Involved in cell surface receptor signaling pathway and response to chloroquine. Predicted to be located in cell surface.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
