Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 249-348 of human MRPL3(NP_009139.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 249-348 of human MRPL3(NP_009139.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08336A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL3 |
| Target Synonyms | MRPL3; COXPD9; MRL3; RPML3; mitochondrial ribosomal protein L3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 249-348 of human MRPL3(NP_009139.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA | Uniprot ID | P09001 |
Uniprot Id
P09001
Target Species
Human
Target Name
MRPL3
Target Full Name
Large ribosomal subunit protein uL3m
Target Involvement
Combined oxidative phosphorylation deficiency 9 (COXPD9)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Universal ribosomal protein uL3 family
Target Synonyms
39S ribosomal protein L3; 39S ribosomal protein L3 mitochondrial; COXPD9; L3mt; Mitochondrial 39S ribosomal protein L3; Mitochondrial 60S ribosomal protein L3; mitochondrial; mitochondrial ribosomal protein; Mitochondrial ribosomal protein L3; MRL3; MRP-L3; MRPL3; RM03_HUMAN; RPML3
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
