Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTCH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human MTCH1 (NP_001258570.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MTCH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human MTCH1 (NP_001258570.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01802A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTCH1 |
| Target Synonyms | PSAP; PIG60; CGI-64; SLC25A49; MTCH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, MCF7, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human MTCH1 (NP_001258570.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYVKLLIQVGHEPMPPTLGTNVLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGVLSSIGKIFKEEGLL | Uniprot ID | Q9NZJ7 |
Uniprot Id
Q9NZJ7
Target Species
Human
Target Name
MTCH1
Target Full Name
Mitochondrial carrier homolog 1
Target Function
Potential mitochondrial transporter. May play a role in apoptosis.
Target Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Target Protein Families
Mitochondrial carrier (TC 2.A.29) family
Target Tissue Specificity
Widely expressed with a predominant expression in brain.
Target Synonyms
MTCH1; PSAP; CGI-64; UNQ1871/PRO4314; Mitochondrial carrier homolog 1; Presenilin-associated protein
Target Background
This gene encodes a member of the mitochondrial carrier family. The encoded protein is localized to the mitochondrion inner membrane and induces apoptosis independent of the proapoptotic proteins Bax and Bak. Pseudogenes on chromosomes 6 and 11 have been identified for this gene. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
